Actinomyces produces defensin-like bacteriocins (Actifensins) with a highly degenerate structure and broad antimicrobial activity
dc.contributor.author | Sugrue, Ivan | |
dc.contributor.author | O'Connor, Paula M. | |
dc.contributor.author | Hill, Colin | |
dc.contributor.author | Stanton, Catherine | |
dc.contributor.author | Ross, R. Paul | |
dc.contributor.funder | Teagasc | en |
dc.contributor.funder | Science Foundation Ireland | en |
dc.contributor.funder | Joint Programming Initiative A healthy diet for a healthy life | en |
dc.date.accessioned | 2020-03-31T11:18:17Z | |
dc.date.available | 2020-03-31T11:18:17Z | |
dc.date.issued | 2020-01-29 | |
dc.date.updated | 2020-03-31T11:04:10Z | |
dc.description.abstract | We identified a strain of Actinomyces ruminicola which produces a potent bacteriocin with activity against a broad range of Gram-positive bacteria, many of which are pathogenic to animals and humans. The bacteriocin was purified and found to have a mass of 4,091 ± 1 Da with a sequence of GFGCNLITSNPYQCSNHCKSVGYRGGYCKLRTVCTCY containing three disulfide bridges. Surprisingly, near relatives of actifensin were found to be a series of related eukaryotic defensins displaying greater than 50% identity to the bacteriocin. A pangenomic screen further revealed that production of actifensin-related bacteriocins is a common trait within the genus, with 47 being encoded in 161 genomes. Furthermore, these bacteriocins displayed a remarkable level of diversity with a mean amino acid identity of only 52% between strains/species. This level of redundancy suggests that this new class of bacteriocins may provide a very broad structural basis on which to deliver and design new broad-spectrum antimicrobials for treatment of animal and human infections. IMPORTANCE: Bacteriocins (ribosomally produced antimicrobial peptides) are potential alternatives to current antimicrobials given the global challenge of antimicrobial resistance. We identified a novel bacteriocin from Actinomyces ruminicola with no previously characterized antimicrobial activity. Using publicly available genomic data, we found a highly conserved yet divergent family of previously unidentified homologous peptide sequences within the genus Actinomyces with striking similarity to eukaryotic defensins. These actifensins may provide a potent line of antimicrobial defense/offense, and the machinery to produce them could be used for the design of new antimicrobials given the degeneracy that exists naturally in their structure. | en |
dc.description.sponsorship | Teagasc (Teagasc Walsh Fellowship); Joint Programming Initiative (JPI Food Processing for Health Longlife Project) | en |
dc.description.status | Peer reviewed | en |
dc.description.version | Published Version | en |
dc.format.mimetype | application/pdf | en |
dc.identifier.articleid | e00529-19 | en |
dc.identifier.citation | Sugrue, I., O'Connor, P. M.; Hill, C., Stanton, C., and Ross, R. P. (2020) 'Actinomyces Produces Defensin-Like Bacteriocins (Actifensins) with a Highly Degenerate Structure and Broad Antimicrobial Activity', Journal of Bacteriology, 202 (4), e00529-19, (15 pp). doi: 10.1128/JB.00529-19 | en |
dc.identifier.doi | 10.1128/JB.00529-19 | en |
dc.identifier.endpage | 15 | en |
dc.identifier.issn | 1098-5530 | |
dc.identifier.issued | 4 | en |
dc.identifier.journaltitle | Journal of Bacteriology | en |
dc.identifier.startpage | 1 | en |
dc.identifier.uri | https://hdl.handle.net/10468/9795 | |
dc.identifier.volume | 202 | en |
dc.language.iso | en | en |
dc.publisher | American Society for Microbiology | en |
dc.relation.project | info:eu-repo/grantAgreement/SFI/SFI Research Centres/12/RC/2273/IE/Alimentary Pharmabiotic Centre (APC) - Interfacing Food & Medicine/ | en |
dc.relation.uri | https://jb.asm.org/content/202/4/e00529-19 | |
dc.rights | © 2020 Sugrue et al. This is an open-access article distributed under the terms of the Creative Commons Attribution 4.0 International license. | en |
dc.rights.uri | https://creativecommons.org/licenses/by/4.0/ | en |
dc.subject | Actifensin | en |
dc.subject | Actinomyces | en |
dc.subject | Antimicrobial peptide | en |
dc.subject | Bacteriocin | en |
dc.subject | Defensin | en |
dc.title | Actinomyces produces defensin-like bacteriocins (Actifensins) with a highly degenerate structure and broad antimicrobial activity | en |
dc.type | Article (peer-reviewed) | en |
Files
Original bundle
1 - 1 of 1
Loading...
- Name:
- Journal of Bacteriology-2020-Sugrue-e00529-19.full.pdf
- Size:
- 4.45 MB
- Format:
- Adobe Portable Document Format
- Description:
- Published version
License bundle
1 - 1 of 1
Loading...
- Name:
- license.txt
- Size:
- 2.71 KB
- Format:
- Item-specific license agreed upon to submission
- Description: